PDB entry 5aen

View 5aen on RCSB PDB site
Description: Structure of human Leukotriene A4 hydrolase in complex with inhibitor dimethyl(2- (4-phenoxyphenoxy)ethyl)amine
Class: hydrolase
Keywords: hydrolase, leukotriene (lt) a4 hydrolase/aminopeptidase, lta4h
Deposited on 2015-01-06, released 2015-02-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukotriene A-4 hydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5aena1, d5aena2, d5aena3
  • Heterogens: DP8, ZN, YB, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aenA (A:)
    ivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltie
    kvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeq
    tsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpe
    dpsrkiykfiqkvpipcylialvvgalesrqigprtlvwsekeqveksayefsetesmlk
    iaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllagdkslsnviaheishswt
    gnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgelqnsvktfgethpf
    tklvvdltdidpdvayssvpyekgfallfyleqllggpeiflgflkayvekfsyksittd
    dwkdflysyfkdkvdvlnqvdwnawlyspglppikpnydmtltnacialsqrwitakedd
    lnsfnatdlkdlsshqlneflaqtlqraplplghikrmqevynfnainnseirfrwlrlc
    iqskwedaiplalkmateqgrmkftrplfkdlaafdkshdqavrtyqehkasmhpvtaml
    vgkdlkvd