PDB entry 5ael

View 5ael on RCSB PDB site
Description: T. Brucei Farnesyl Diphosphate Synthase Complexed with Bisphosphonate BPH-597
Class: transferase
Keywords: transferase
Deposited on 2014-12-26, released 2015-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aela_
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aelb_
  • Heterogens: QAF, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aelA (A:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr
    hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf
    dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt
    eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka
    nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg
    ktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aelA (A:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llsdgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqcai
    ndglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdvs
    qptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmgey
    fqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsekv
    atvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5aelB (B:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr
    hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf
    dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt
    eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka
    nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg
    ktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aelB (B:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llsdgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqcai
    ndglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdvs
    qptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmgey
    fqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsekv
    atvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk