PDB entry 5aek

View 5aek on RCSB PDB site
Description: Crystal structure of the human SENP2 C548S in complex with the human SUMO1 K48M F66W
Class: hydrolase
Keywords: hydrolase, sumo, senp, folding evolution
Deposited on 2014-12-23, released 2016-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (Start-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aeka_
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (0-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekb_
  • Chain 'C':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (0-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aekc_
  • Chain 'D':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (0-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekd_
  • Chain 'E':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (0-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aeke_
  • Chain 'F':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (0-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekf_
  • Chain 'G':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (Start-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aekg_
  • Chain 'H':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (Start-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekh_
  • Chain 'I':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (Start-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aeki_
  • Chain 'J':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (0-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekj_
  • Chain 'K':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (Start-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aekk_
  • Chain 'L':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (Start-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekl_
  • Chain 'M':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (Start-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aekm_
  • Chain 'N':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (0-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekn_
  • Chain 'O':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (Start-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aeko_
  • Chain 'P':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (0-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekp_
  • Chain 'Q':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (0-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aekq_
  • Chain 'R':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (0-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekr_
  • Chain 'S':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (0-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aeks_
  • Chain 'T':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (0-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekt_
  • Chain 'U':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (Start-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aeku_
  • Chain 'V':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (0-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekv_
  • Chain 'W':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (Start-223)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d5aekw_
  • Chain 'X':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (0-77)
      • engineered mutation (28)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5aekx_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aekA (A:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aekA (A:)
    eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
    nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
    rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
    dsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekB (B:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekC (C:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekD (D:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekE (E:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekF (F:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5aekG (G:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aekG (G:)
    eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
    nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
    rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
    dsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5aekH (H:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aekH (H:)
    yiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpkel
    gmeeedvievyqeqtgg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5aekI (I:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aekI (I:)
    eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
    nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
    rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
    dsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekJ (J:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5aekK (K:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aekK (K:)
    eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
    nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
    rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
    dsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5aekL (L:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aekL (L:)
    yiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpkel
    gmeeedvievyqeqtgg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5aekM (M:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aekM (M:)
    ltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllvern
    kkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidlr
    kkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngsd
    sgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekN (N:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5aekO (O:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aekO (O:)
    eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
    nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
    rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
    dsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekP (P:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekQ (Q:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekR (R:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekS (S:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekT (T:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5aekU (U:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aekU (U:)
    eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
    nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
    rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
    dsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekV (V:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5aekW (W:)
    leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
    rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
    lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
    sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aekW (W:)
    ltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllvern
    kkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidlr
    kkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngsd
    sgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aekX (X:)
    eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
    lgmeeedvievyqeqtgg