PDB entry 5acc

View 5acc on RCSB PDB site
Description: A Novel Oral Selective Estrogen Receptor Down-regulator, AZD9496, drives Tumour Growth Inhibition in Estrogen Receptor positive and ESR1 Mutant Models
Class: signaling protein
Keywords: signaling protein, serd, metastatic breast cancer, er mutation, esr1 mutation, combination therapy
Deposited on 2015-08-15, released 2015-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-End)
      • engineered mutation (74)
      • engineered mutation (110)
      • engineered mutation (229)
    Domains in SCOPe 2.06: d5acca_
  • Heterogens: KE9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5accA (A:)
    alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
    ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemlda
    hrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5accA (A:)
    alsltadqmvsalldaeppilyseydptrpfsmmglltnladrelvhminwakrvpgfvd
    ltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmll
    atssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmak
    agltlqqqhqrlaqlllilshirhmsnkgmehlysmvpsydlllemld