PDB entry 5aal

View 5aal on RCSB PDB site
Description: Complex of the FimH lectin with a C-linked para-biphenyl ethylene alpha-D-mannoside in soaked trigonal crystals at 2.45 A resolution
Class: sugar binding protein
Keywords: sugar binding protein, bacterial adhesin, type 1 fimbriae, urinary tract infection, variable immunoglobulin fold
Deposited on 2015-07-27, released 2016-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:364106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5aala_
  • Chain 'B':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:364106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5aalb_
  • Heterogens: 8L8, NI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5aalA (A:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5aalB (B:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt