PDB entry 5aa7

View 5aa7 on RCSB PDB site
Description: Structural and functional characterization of a chitin-active 15.5 kDa lytic polysaccharide monooxygenase domain from a modular chitinase from Jonesia denitrificans
Class: hydrolase
Keywords: hydrolase
Deposited on 2015-07-23, released 2015-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase
    Species: JONESIA DENITRIFICANS [TaxId:43674]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5aa7a_
  • Chain 'B':
    Compound: chitinase
    Species: JONESIA DENITRIFICANS [TaxId:43674]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5aa7b_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aa7A (A:)
    hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
    tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
    larwnvsntnnafyncmdvvvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aa7B (B:)
    hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
    tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
    larwnvsntnnafyncmdvvvs