PDB entry 5a9g

View 5a9g on RCSB PDB site
Description: Manganese Superoxide Dismutase from Sphingobacterium sp. T2
Class: oxidoreductase
Keywords: oxidoreductase, lignin valorisation, lignin oxidation, manganese superoxide dismutase, sphingobacterium
Deposited on 2015-07-21, released 2015-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: SPHINGOBACTERIUM SPIRITIVORUM [TaxId:258]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A9G
    Domains in SCOPe 2.07: d5a9ga1, d5a9ga2, d5a9ga3
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: SPHINGOBACTERIUM SPIRITIVORUM [TaxId:258]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A9G
    Domains in SCOPe 2.07: d5a9gb1, d5a9gb2, d5a9gb3
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a9gA (A:)
    mhhhhhhgkpipnpllgldstenlyfqgidpftqfkqtplpyaydalegaidaktmeihy
    skhaagytanlnkaiagtpaekesienilakvsqysdavrnnagghynhelfwsiltpnk
    gtkpsaalqkaidetfgsldalkekinaagaarfgsgwawlivdnggklqvtstpnqdnp
    lmdftkekgtpilgidvwehayylryqnkradylttiwdvinweevsaryekalkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a9gA (A:)
    dpftqfkqtplpyaydalegaidaktmeihyskhaagytanlnkaiagtpaekesienil
    akvsqysdavrnnagghynhelfwsiltpnkgtkpsaalqkaidetfgsldalkekinaa
    gaarfgsgwawlivdnggklqvtstpnqdnplmdftkekgtpilgidvwehayylryqnk
    radylttiwdvinweevsaryekalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a9gB (B:)
    mhhhhhhgkpipnpllgldstenlyfqgidpftqfkqtplpyaydalegaidaktmeihy
    skhaagytanlnkaiagtpaekesienilakvsqysdavrnnagghynhelfwsiltpnk
    gtkpsaalqkaidetfgsldalkekinaagaarfgsgwawlivdnggklqvtstpnqdnp
    lmdftkekgtpilgidvwehayylryqnkradylttiwdvinweevsaryekalkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a9gB (B:)
    dpftqfkqtplpyaydalegaidaktmeihyskhaagytanlnkaiagtpaekesienil
    akvsqysdavrnnagghynhelfwsiltpnkgtkpsaalqkaidetfgsldalkekinaa
    gaarfgsgwawlivdnggklqvtstpnqdnplmdftkekgtpilgidvwehayylryqnk
    radylttiwdvinweevsaryekalk