PDB entry 5a86

View 5a86 on RCSB PDB site
Description: Structure of pregnane X receptor in complex with a Sphingosine 1- Phosphate Receptor 1 Antagonist
Class: signaling protein
Keywords: signaling protein, pxr ligand, pxr agonist, cyp3a4 induction, nuclear receptor
Deposited on 2015-07-13, released 2015-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 1 group I member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a86a_
  • Chain 'B':
    Compound: Nuclear receptor subfamily 1 group I member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a86b_
  • Chain 'C':
    Compound: Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: D7E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a86A (A:)
    mkkghhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvl
    ssgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifs
    llphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgt
    wecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlq
    hrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdih
    pfatplmqelfgit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a86A (A:)
    lteeqrmmirelmdaqmktfdttfshfknfrlpgveeaakwsqvrkdlcslkvslqlrge
    dgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqisllkg
    aafelcqlrfntvfnaetgtwecgrlsycledtaqqlllepmlkfhymlkklqlheeeyv
    lmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelr
    sinaqhtqrllriqdihpfatplmqelfgit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a86B (B:)
    mkkghhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvl
    ssgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifs
    llphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgt
    wecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlq
    hrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdih
    pfatplmqelfgit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a86B (B:)
    qglteeqrmmirelmdaqmktfdttfshfknfrlpgvsreeaakwsqvrkdlcslkvslq
    lrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqis
    llkgaafelcqlrfntvfnaetgtwecgrlsycledgfqqlllepmlkfhymlkklqlhe
    eeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkimaml
    telrsinaqhtqrllriqdihpfatplmqelfgi
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.