PDB entry 5a6r

View 5a6r on RCSB PDB site
Description: Crystal structure of the BTB domain of human KCTD17
Class: hydrolase
Keywords: hydrolase
Deposited on 2015-06-30, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: btb/poz domain-containing protein kctd17
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6ra_
  • Chain 'B':
    Compound: btb/poz domain-containing protein kctd17
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6rb_
  • Chain 'C':
    Compound: btb/poz domain-containing protein kctd17
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6rc_
  • Chain 'D':
    Compound: btb/poz domain-containing protein kctd17
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6rd_
  • Chain 'E':
    Compound: btb/poz domain-containing protein kctd17
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6re_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a6rA (A:)
    mhhhhhhssgvdlgtenlyfqsmgaggraaggwgkwvrlnvggtvflttrqtlcreqksf
    lsrlcqgeelqsdrdetgaylidrdptyfgpilnflrhgklvldkdmaeegvleeaefyn
    igpliriikdrmeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a6rA (A:)
    wgkwvrlnvggtvflttrqtlcreqksflsrlcqgeelqsdrdetgaylidrdptyfgpi
    lnflrhgklvldkdmaeegvleeaefynigpliriikdrmee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a6rB (B:)
    mhhhhhhssgvdlgtenlyfqsmgaggraaggwgkwvrlnvggtvflttrqtlcreqksf
    lsrlcqgeelqsdrdetgaylidrdptyfgpilnflrhgklvldkdmaeegvleeaefyn
    igpliriikdrmeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a6rB (B:)
    wgkwvrlnvggtvflttrqtlcreqksflsrlcqgeelqsdrdetgaylidrdptyfgpi
    lnflrhgklvldkdmaeegvleeaefynigpliriikdrme
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5a6rC (C:)
    mhhhhhhssgvdlgtenlyfqsmgaggraaggwgkwvrlnvggtvflttrqtlcreqksf
    lsrlcqgeelqsdrdetgaylidrdptyfgpilnflrhgklvldkdmaeegvleeaefyn
    igpliriikdrmeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a6rC (C:)
    wgkwvrlnvggtvflttrqtlcreqksflsrlcqgeelqsdrdetgaylidrdptyfgpi
    lnflrhgklvldkdmaeegvleeaefynigpliriikdrmee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5a6rD (D:)
    mhhhhhhssgvdlgtenlyfqsmgaggraaggwgkwvrlnvggtvflttrqtlcreqksf
    lsrlcqgeelqsdrdetgaylidrdptyfgpilnflrhgklvldkdmaeegvleeaefyn
    igpliriikdrmeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a6rD (D:)
    wgkwvrlnvggtvflttrqtlcreqksflsrlcqgeelqsdrdetgaylidrdptyfgpi
    lnflrhgklvldkdmaeegvleeaefynigpliriikdrme
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5a6rE (E:)
    mhhhhhhssgvdlgtenlyfqsmgaggraaggwgkwvrlnvggtvflttrqtlcreqksf
    lsrlcqgeelqsdrdetgaylidrdptyfgpilnflrhgklvldkdmaeegvleeaefyn
    igpliriikdrmeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a6rE (E:)
    wgkwvrlnvggtvflttrqtlcreqksflsrlcqgeelqsdrdetgaylidrdptyfgpi
    lnflrhgklvldkdmaeegvleeaefynigpliriikdrme