PDB entry 5a5j

View 5a5j on RCSB PDB site
Description: Cytochrome 2C9 P450 inhibitor complex
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2015-06-18, released 2016-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2C9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11712 (Start-471)
      • expression tag (472-474)
    Domains in SCOPe 2.07: d5a5ja1, d5a5ja2
  • Heterogens: HEM, 6YF

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a5jA (A:)
    makktssgrgklppgptplpvignilqigikdisksltnlskvygpvftlyfglkpivvl
    hgyeavkealidlgeefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmg
    krsiedrvqeearclveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnl
    meklnenikilsspwiqicnnfspiidyfpgthnkllknvafmksyilekvkehqesmdm
    nnpqdfidcflmkmekekhnqpseftieslentavdlfgagtettsttlryalllllkhp
    evtakvqeeiervigrnrspcmqdrshmpytdavvhevqryidllptslphavtcdikfr
    nylipkgttilisltsvlhdnkefpnpemfdphhfldeggnfkkskyfmpfsagkricvg
    ealagmelflfltsilqnfnlkslvdpknldttpvvngfasvppfyqlcfipihhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5jA (A:)
    rgklppgptplplqigikdisksltnlskvygpvftlyfglkpivvlhgyeavkealidl
    geefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrvqeear
    clveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklnenikilss
    pwipiidyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfidcflmkmekekhn
    qpseftieslentavdlfgagtettsttlryalllllkhpevtakvqeeiervigrnrsp
    cmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgttilisltsvlhd
    nkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmelflfltsilqnfn
    lkslvdpknldttpvvngfasvppfyqlcfipihh