PDB entry 5a4c

View 5a4c on RCSB PDB site
Description: FGFR1 ligand complex
Class: transferase
Keywords: transferase, kinase
Deposited on 2015-06-05, released 2015-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, pfeiffer syndrome), isoform cra_b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-306)
      • engineered mutation (125)
    Domains in SCOPe 2.07: d5a4ca_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, pfeiffer syndrome), isoform cra_b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (2-306)
      • expression tag (0-1)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d5a4cb1, d5a4cb2
  • Heterogens: SO4, EDO, XOJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a4cA (A:)
    gaseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlks
    datekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrp
    pgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmk
    iadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlgg
    spypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldriv
    altsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a4cA (A:)
    elpedprwelprdrlvlgkplgefgqvvlaeaigldkdkpnrvtkvavkmlksdatekdl
    sdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgleysy
    npshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgli
    dyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfk
    llkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a4cB (B:)
    gaseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlks
    datekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrp
    pgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmk
    iadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlgg
    spypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldriv
    altsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a4cB (B:)
    gaseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldpnrvtkvavkmlksdat
    ekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeq
    lsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglaidyykkttn
    grlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrm
    dkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe