PDB entry 5a2d

View 5a2d on RCSB PDB site
Description: crystal structure of betaine aldehyde dehydrogenase from spinach showing a thiohemiacetal with betaine aldehyde
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2015-05-17, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a2da_
  • Chain 'B':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a2db_
  • Chain 'C':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a2dc_
  • Chain 'D':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a2dd_
  • Heterogens: CHT, ETX, K, PG4, AE3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a2dA (A:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyksp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a2dA (A:)
    piparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnnw
    satsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqae
    aldgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlkp
    selasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgskv
    masaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvhesi
    aaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsrp
    ehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaavf
    sndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqvt
    qdisdepwgwyks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a2dB (B:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyksp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a2dB (B:)
    piparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnnw
    satsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqae
    aldgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlkp
    selasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgskv
    masaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvhesi
    aaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsrp
    ehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaavf
    sndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqvt
    qdisdepwgwyks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5a2dC (C:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyksp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a2dC (C:)
    iparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnnws
    atsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqaea
    ldgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlkps
    elasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgskvm
    asaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvhesia
    aefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsrpe
    hlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaavfs
    ndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqvtq
    disdepwgwyks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5a2dD (D:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyksp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a2dD (D:)
    piparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnnw
    satsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqae
    aldgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlkp
    selasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgskv
    masaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvhesi
    aaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsrp
    ehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaavf
    sndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqvt
    qdisdepwgwyks