PDB entry 5a24

View 5a24 on RCSB PDB site
Description: Crystal structure of Dionain-1, the major endopeptidase in the Venus flytrap digestive juice
Class: hydrolase
Keywords: hydrolase, cysteine peptidase, venus flytrap, digestive enzyme, acidic enzyme
Deposited on 2015-05-12, released 2015-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-02-10, with a file datestamp of 2016-02-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dionain-1
    Species: DIONAEA MUSCIPULA [TaxId:4362]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A24 (0-221)
    Domains in SCOPe 2.08: d5a24a_
  • Heterogens: E64, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a24A (A:)
    vpaavdwrtagavtpvknqqqcgccwafsavaaiegatqiktgtltslseeqivdcdtng
    ndkgcnggtpdgafqyvvnnqgidtesdypytagggspgtcsassyqpaasitgyqdvpa
    nneqalqqaaatqpisvaidasdpsfqsyssgiysgpcntnldhavtvvgygtdpnsgns
    ywivknswgtswgqegyiwmqmglnapygvcgiamqasypta