PDB entry 5a1t

View 5a1t on RCSB PDB site
Description: Trichomonas vaginalis lactate dehydrogenase in complex with NADH and oxamate
Class: oxidoreductase
Keywords: oxidoreductase, lactate dehydrogenase
Deposited on 2015-05-05, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Trichomonas vaginalis [TaxId:5722]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a1ta1, d5a1ta2, d5a1ta3
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Trichomonas vaginalis [TaxId:5722]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a1tb1, d5a1tb2
  • Heterogens: NAI, OXM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a1tA (A:)
    mseaahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledca
    fphlagfvattdpkaafkdidcaflvasmplkpgqvradlissnsvifkntgeylskwak
    psvkvlvignpdntnceiamlhaknlkpenfsslsmldqnrayyevasklgvdvkdvhdi
    ivwgnhgesmvadltqatftkegktqkvvdvldhdyvfdtffkkighrawdilehrgfts
    aasptkaaiqhmkawlfgtapgevlsmgipvpegnpygikpgvvfsfpcnvdkegkihvv
    egfkvndwlrekldftekdlfhekeialnhlaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a1tA (A:)
    aahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledcafph
    lagfvattdpkaafkdidcaflvasmplkpgqvradlissnsvifkntgeylskwakpsv
    kvlvignpdntnceiamlhaknlkpenfsslsmldqnrayyevasklgvdvkdvhdiivw
    gnhgesmvadltqatftkegktqkvvdvldhdyvfdtffkkighrawdilehrgftsaas
    ptkaaiqhmkawlfgtapgevlsmgipvpegnpygikpgvvfsfpcnvdkegkihvvegf
    kvndwlrekldftekdlfhekeialnhlaql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a1tB (B:)
    mseaahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledca
    fphlagfvattdpkaafkdidcaflvasmplkpgqvradlissnsvifkntgeylskwak
    psvkvlvignpdntnceiamlhaknlkpenfsslsmldqnrayyevasklgvdvkdvhdi
    ivwgnhgesmvadltqatftkegktqkvvdvldhdyvfdtffkkighrawdilehrgfts
    aasptkaaiqhmkawlfgtapgevlsmgipvpegnpygikpgvvfsfpcnvdkegkihvv
    egfkvndwlrekldftekdlfhekeialnhlaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a1tB (B:)
    aahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledcafph
    lagfvattdpkaafkdidcaflvasmplkpgqvradlissnsvifkntgeylskwakpsv
    kvlvignpdntnceiamlhaknlkpenfsslsmldqnrayyevasklgvdvkdvhdiivw
    gnhgesmvadltqatftkegktqkvvdvldhdyvfdtffkkighrawdilehrgftsaas
    ptkaaiqhmkawlfgtapgevlsmgipvpegnpygikpgvvfsfpcnvdkegkihvvegf
    kvndwlrekldftekdlfhekeialnhl