PDB entry 5a1p

View 5a1p on RCSB PDB site
Description: Crystal structure of cytochrome P450 3A4 bound to progesterone and citrate
Class: oxidoreductase
Keywords: oxidoreductase, cytochrome p450 3a4, cyp3a4, monooxygenase, progesterone, citrate
Deposited on 2015-05-04, released 2015-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a1pa_
  • Heterogens: HEM, STR, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a1pA (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a1pA (A:)
    gthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlait
    dpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkem
    vpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfve
    ntkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtr
    vdflqlmidsqnsshkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklq
    eeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgv
    vvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnm
    klalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd