PDB entry 5a1a

View 5a1a on RCSB PDB site
Description: 2.2 A resolution cryo-EM structure of beta-galactosidase in complex with a cell-permeant inhibitor
Class: hydrolase
Keywords: hydrolase, near-atomic, near-atomic resolution cryo-electron microscopy, single- particle cryo-em, protein complexes, petg
Deposited on 2015-04-29, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: EM
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a1aA (A:)
    mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
    wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
    cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
    nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravle
    aevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklw
    saeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhp
    lhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmv
    pmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdps
    rpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaha
    mgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqf
    cmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgk
    plasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwr
    laenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplr
    dqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittaha
    wqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglg
    pqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisr
    ysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwc
    qk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a1aB (B:)
    mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
    wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
    cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
    nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravle
    aevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklw
    saeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhp
    lhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmv
    pmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdps
    rpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaha
    mgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqf
    cmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgk
    plasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwr
    laenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplr
    dqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittaha
    wqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglg
    pqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisr
    ysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwc
    qk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a1aC (C:)
    mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
    wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
    cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
    nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravle
    aevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklw
    saeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhp
    lhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmv
    pmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdps
    rpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaha
    mgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqf
    cmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgk
    plasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwr
    laenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplr
    dqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittaha
    wqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglg
    pqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisr
    ysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwc
    qk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a1aD (D:)
    mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
    wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
    cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
    nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravle
    aevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklw
    saeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhp
    lhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmv
    pmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdps
    rpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaha
    mgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqf
    cmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgk
    plasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwr
    laenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplr
    dqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittaha
    wqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglg
    pqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisr
    ysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwc
    qk