PDB entry 5a16

View 5a16 on RCSB PDB site
Description: Crystal structure of Fab4201 raised against Human Erythrocyte Anion Exchanger 1
Class: immune system
Keywords: immune system, fab fragment, anion exchanger
Deposited on 2015-04-28, released 2015-06-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab4201 heavy chain
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A16 (0-End)
  • Chain 'B':
    Compound: fab4201 heavy chain
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A16 (0-217)
    Domains in SCOPe 2.05: d5a16b1, d5a16b2
  • Chain 'C':
    Compound: fab4201 heavy chain
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A16 (0-End)
  • Chain 'D':
    Compound: fab4201 heavy chain
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A16 (0-217)
    Domains in SCOPe 2.05: d5a16d1, d5a16d2
  • Chain 'E':
    Compound: fab4201 heavy chain
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A16 (0-End)
  • Chain 'F':
    Compound: fab4201 heavy chain
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A16 (0-217)
    Domains in SCOPe 2.05: d5a16f1, d5a16f2
  • Chain 'G':
    Compound: fab4201 heavy chain
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A16 (0-End)
  • Chain 'H':
    Compound: fab4201 heavy chain
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A16 (0-217)
    Domains in SCOPe 2.05: d5a16h1, d5a16h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a16B (B:)
    divmtqspaslavslgqratiscrasqsvstssysymnwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftlnihpleeedtatyycqhsweipwtfgggtkveikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a16D (D:)
    divmtqspaslavslgqratiscrasqsvstssysymnwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftlnihpleeedtatyycqhsweipwtfgggtkveikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a16F (F:)
    divmtqspaslavslgqratiscrasqsvstssysymnwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftlnihpleeedtatyycqhsweipwtfgggtkveikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a16H (H:)
    divmtqspaslavslgqratiscrasqsvstssysymnwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftlnihpleeedtatyycqhsweipwtfgggtkveikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec