PDB entry 5a15

View 5a15 on RCSB PDB site
Description: Crystal structure of the BTB domain of human KCTD16
Class: signaling protein
Keywords: signaling protein
Deposited on 2015-04-28, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15a_
  • Chain 'B':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15b_
  • Chain 'C':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15c_
  • Chain 'D':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15d_
  • Chain 'E':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15e_
  • Chain 'F':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15f_
  • Chain 'G':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15g_
  • Chain 'H':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15h_
  • Chain 'I':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15i_
  • Chain 'J':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15j_
  • Chain 'K':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15k_
  • Chain 'L':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15l_
  • Chain 'M':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15m_
  • Chain 'N':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15n_
  • Chain 'O':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a15o_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a15A (A:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15A (A:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a15B (B:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15B (B:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5a15C (C:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15C (C:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5a15D (D:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15D (D:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5a15E (E:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15E (E:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5a15F (F:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15F (F:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5a15G (G:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15G (G:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5a15H (H:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15H (H:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5a15I (I:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15I (I:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5a15J (J:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15J (J:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5a15K (K:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15K (K:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5a15L (L:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15L (L:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5a15M (M:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15M (M:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5a15N (N:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15N (N:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5a15O (O:)
    smgsavpnsfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrf
    fidrdgflfryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a15O (O:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp