PDB entry 5a0f

View 5a0f on RCSB PDB site
Description: Crystal structure of Yersinia Afp18-modified RhoA
Class: signaling protein
Keywords: signaling protein, n-acetylglucosamine-protein, tyrosine glycosylation, gtpase, bacterial toxin effector, type 6 secretion system, antifeeding prophage
Deposited on 2015-04-20, released 2015-07-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5a0fa_
  • Heterogens: GDP, SO4, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a0fA (A:)
    maairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a0fA (A:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq