PDB entry 4zzx

View 4zzx on RCSB PDB site
Description: Structure of PARP2 catalytic domain bound to an isoindolinone inhibitor
Class: transferase
Keywords: transferase
Deposited on 2015-04-15, released 2015-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zzxa1, d4zzxa2
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zzxb1, d4zzxb2
  • Heterogens: FSU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zzxA (A:)
    gpslksplkpesqldlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyq
    slkkiedciragqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdi
    eiaiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqsthapthsdytmt
    lldlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriappeapitgymfgkg
    iyfadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqgkhstkglgk
    mapssahfvtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmryllkvqfnfl
    qlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zzxA (A:)
    esqldlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedcir
    agqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvkte
    lqspehpldqhyrnlhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekd
    gekeafredlhnrmllwhgsrmsnwvgilshglriappeapitgymfgkgiyfadmssks
    anycfasrlkntgllllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvt
    lngstvplgpasdtgilngytlnyneyivynpnqvrmryllkvqfnflqlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zzxB (B:)
    gpslksplkpesqldlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyq
    slkkiedciragqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdi
    eiaiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqsthapthsdytmt
    lldlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriappeapitgymfgkg
    iyfadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqgkhstkglgk
    mapssahfvtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmryllkvqfnfl
    qlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zzxB (B:)
    qldlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedcirag
    qhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktelq
    shpldqhyrnlhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgeke
    afredlhnrmllwhgsrmsnwvgilshglriappeapitgymfgkgiyfadmssksanyc
    fasrlkntgllllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngs
    tvplgpasdtgilnpdgytlnyneyivynpnqvrmryllkvqfnflqlw