PDB entry 4zzd

View 4zzd on RCSB PDB site
Description: crystal structure of multidrug resistance regulator lmrr bound to riboflavin
Class: transcription
Keywords: winged helix turn helix, transcription regulator, multidrug binding, intracellular, transcription
Deposited on 2015-05-22, released 2015-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, PadR-like family
    Species: LACTOCOCCUS LACTIS SUBSP. CREMORIS MG1363 [TaxId:416870]
    Gene: llmg_0323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zzda_
  • Heterogens: RBF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zzdA (A:)
    maeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
    giissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zzdA (A:)
    pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
    sywgdrkyyrlteighenmrlafeswsrvdkiienlea