PDB entry 4zy3

View 4zy3 on RCSB PDB site
Description: Crystal Structure of Keap1 in Complex with a small chemical compound, K67
Class: transcription
Keywords: Nrf2, Keap1, Stress sensor, Small molecule binding, Double glycine repeat, Kelch domain, p62, Transcription
Deposited on 2015-05-21, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Keap1, Inrf2, Kiaa0132
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zy3a_
  • Chain 'B':
    Compound: Kelch-like ECH-associated protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Keap1, Inrf2, Kiaa0132
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zy3b_
  • Heterogens: FMT, K67, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zy3A (A:)
    mghhhhhhdydipttenlyfqgapkvgrliytaggyfrqslsyleaynpsngswlrladl
    qvprsglagcvvggllyavggrnnspdgntdssaldcynpmtnqwspcasmsvprnrigv
    gvidghiyavggshgcihhssveryeperdewhlvapmltrrigvgvavlnrllyavggf
    dgtnrlnsaecyypernewrmitpmntirsgagvcvlhnciyaaggydgqdqlnsveryd
    vetetwtfvapmrhhrsalgitvhqgkiyvlggydghtfldsvecydpdsdtwsevtrmt
    sgrsgvgvavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zy3A (A:)
    grliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnnsp
    dgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssverye
    perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpmn
    tirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhqg
    kiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zy3B (B:)
    mghhhhhhdydipttenlyfqgapkvgrliytaggyfrqslsyleaynpsngswlrladl
    qvprsglagcvvggllyavggrnnspdgntdssaldcynpmtnqwspcasmsvprnrigv
    gvidghiyavggshgcihhssveryeperdewhlvapmltrrigvgvavlnrllyavggf
    dgtnrlnsaecyypernewrmitpmntirsgagvcvlhnciyaaggydgqdqlnsveryd
    vetetwtfvapmrhhrsalgitvhqgkiyvlggydghtfldsvecydpdsdtwsevtrmt
    sgrsgvgvavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zy3B (B:)
    grliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnnsp
    dgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssverye
    perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpmn
    tirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhqg
    kiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavt