PDB entry 4zxo

View 4zxo on RCSB PDB site
Description: The structure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A.
Class: hydrolase
Keywords: Mannanase, Hydrolase, GH26, CAZy
Deposited on 2015-05-20, released 2016-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycosyl hydrolase family 26
    Species: BACTEROIDES OVATUS [TaxId:28116]
    Gene: BACOVA_02092
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7LW88 (Start-343)
      • expression tag (344-350)
    Domains in SCOPe 2.06: d4zxoa1, d4zxoa2
  • Heterogens: K, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zxoA (A:)
    gsgetgektpetvallqnlkqaerkgilfghhddtaygigwegdkgrsdvksvcgaypgv
    msfdlgeielggthnldkvsfahlreyiieqyarggmislswhvrnpktggdswdvtdst
    vvasvmqggenhvkmlewidrvadfllslktkegvlipvvfrpwhehtgswfwwgkdlcs
    seqyktlwrmtndrlrlkgvnnvllayspgmesdtveeylerypgddiidvlgtdvyqfe
    rsqyikqlnkmltilteagkkhdkpialtetglegipdslwwtgtllpviekyplsyvlv
    wrnareksthyyapypgqvsaddfvkfsrspkilfvgdnfelyklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zxoA (A:)
    ktpetvallqnlkqaerkgilfghhddtaygigwegdkgrsdvksvcgaypgvmsfdlge
    ielggthnldkvsfahlreyiieqyarggmislswhvrnpktggdswdvtdstvvasvmq
    ggenhvkmlewidrvadfllslktkegvlipvvfrpwhehtgswfwwgkdlcsseqyktl
    wrmtndrlrlkgvnnvllayspgmesdtveeylerypgddiidvlgtdvyqfersqyikq
    lnkmltilteagkkhdkpialtetglegipdslwwtgtllpviekyplsyvlvwrnarek
    sthyyapypgqvsaddfvkfsrspkilfvgdnfelyklehhhhh