PDB entry 4zwn

View 4zwn on RCSB PDB site
Description: Crystal Structure of a Soluble Variant of the Monoglyceride Lipase from Saccharomyces Cerevisiae
Class: hydrolase
Keywords: Monoglyceride Lipase, Monoacylglycerol Lipase, Serine Hydrolase, Alpha/Beta Hydrolase, hydrolase
Deposited on 2015-05-19, released 2016-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoglyceride lipase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YJU3, YKL094W, YKL441
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28321 (22-End)
      • expression tag (21)
      • engineered mutation (195)
      • engineered mutation (284)
    Domains in SCOPe 2.06: d4zwna1, d4zwna2
  • Chain 'B':
    Compound: Monoglyceride lipase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YJU3, YKL094W, YKL441
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28321 (22-End)
      • expression tag (21)
      • engineered mutation (195)
      • engineered mutation (284)
    Domains in SCOPe 2.06: d4zwnb1, d4zwnb2
  • Chain 'C':
    Compound: Monoglyceride lipase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YJU3, YKL094W, YKL441
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28321 (22-End)
      • expression tag (21)
      • engineered mutation (195)
      • engineered mutation (284)
    Domains in SCOPe 2.06: d4zwnc1, d4zwnc2
  • Chain 'D':
    Compound: Monoglyceride lipase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YJU3, YKL094W, YKL441
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28321 (22-End)
      • expression tag (21)
      • engineered mutation (195)
      • engineered mutation (284)
    Domains in SCOPe 2.06: d4zwnd1, d4zwnd2
  • Heterogens: NO3, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zwnA (A:)
    hhhhdydipttenlyfqgamgsapypykvqttvpelqyenfdgakfgymfwpvqngtnev
    rgrvllihgfgeytkiqfrlmdhlslngyesftfdqrgagvtspgrskgvtdeyhvfndl
    ehfveknlseckakgiplfmwghsmgggiclnyacqgkhkneisgyigsgpliilhphtm
    ynkptqiiapllakfsprvridtgldlkgitsdkayraflgsdpmsvplygsfrqihdfm
    qrgaklyknennyiqknfakdkpviimhgqddtindpkgsekfirdcpsadkelklypga
    rhsifsletdkvfntvfndmkqwldkhttteakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zwnA (A:)
    sapypykvqttvpelqyenfdgakfgymfwpvqngtnevrgrvllihgfgeytkiqfrlm
    dhlslngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmw
    ghsmgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvri
    dtgldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakd
    kpviimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmk
    qwldkhttte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zwnB (B:)
    hhhhdydipttenlyfqgamgsapypykvqttvpelqyenfdgakfgymfwpvqngtnev
    rgrvllihgfgeytkiqfrlmdhlslngyesftfdqrgagvtspgrskgvtdeyhvfndl
    ehfveknlseckakgiplfmwghsmgggiclnyacqgkhkneisgyigsgpliilhphtm
    ynkptqiiapllakfsprvridtgldlkgitsdkayraflgsdpmsvplygsfrqihdfm
    qrgaklyknennyiqknfakdkpviimhgqddtindpkgsekfirdcpsadkelklypga
    rhsifsletdkvfntvfndmkqwldkhttteakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zwnB (B:)
    sapypykvqttvpelqyenfdgakfgymfwpvqngtnevrgrvllihgfgeytkiqfrlm
    dhlslngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmw
    ghsmgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvri
    dtgldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakd
    kpviimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmk
    qwldkhtttea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zwnC (C:)
    hhhhdydipttenlyfqgamgsapypykvqttvpelqyenfdgakfgymfwpvqngtnev
    rgrvllihgfgeytkiqfrlmdhlslngyesftfdqrgagvtspgrskgvtdeyhvfndl
    ehfveknlseckakgiplfmwghsmgggiclnyacqgkhkneisgyigsgpliilhphtm
    ynkptqiiapllakfsprvridtgldlkgitsdkayraflgsdpmsvplygsfrqihdfm
    qrgaklyknennyiqknfakdkpviimhgqddtindpkgsekfirdcpsadkelklypga
    rhsifsletdkvfntvfndmkqwldkhttteakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zwnC (C:)
    sapypykvqttvpelqyenfdgakfgymfwpvqngtnevrgrvllihgfgeytkiqfrlm
    dhlslngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmw
    ghsmgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvri
    dtgldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakd
    kpviimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmk
    qwldkhtt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zwnD (D:)
    hhhhdydipttenlyfqgamgsapypykvqttvpelqyenfdgakfgymfwpvqngtnev
    rgrvllihgfgeytkiqfrlmdhlslngyesftfdqrgagvtspgrskgvtdeyhvfndl
    ehfveknlseckakgiplfmwghsmgggiclnyacqgkhkneisgyigsgpliilhphtm
    ynkptqiiapllakfsprvridtgldlkgitsdkayraflgsdpmsvplygsfrqihdfm
    qrgaklyknennyiqknfakdkpviimhgqddtindpkgsekfirdcpsadkelklypga
    rhsifsletdkvfntvfndmkqwldkhttteakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zwnD (D:)
    sapypykvqttvpelqyenfdgakfgymfwpvqngtnevrgrvllihgfgeytkiqfrlm
    dhlslngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmw
    ghsmgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvri
    dtgldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakd
    kpviimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmk
    qwldkhtt