PDB entry 4zvw

View 4zvw on RCSB PDB site
Description: Structure of apo human ALDH7A1 in space group C2
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, NAD, oxidoreductase, lysine catabolism
Deposited on 2015-05-18, released 2015-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zvwa_
  • Chain 'B':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zvwb_
  • Chain 'C':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zvwc_
  • Chain 'D':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zvwd_
  • Chain 'E':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zvwe_
  • Chain 'F':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zvwf_
  • Chain 'G':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zvwg_
  • Chain 'H':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zvwh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zvwA (A:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvwA (A:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zvwB (B:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvwB (B:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zvwC (C:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvwC (C:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zvwD (D:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvwD (D:)
    llinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyeet
    vkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqeyv
    dicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiamic
    gnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnlls
    ftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrct
    tarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakke
    ggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnnev
    kqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgsd
    awkqymrrstctinyskdlplaqgikfq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zvwE (E:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvwE (E:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zvwF (F:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvwF (F:)
    llinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyeet
    vkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqeyv
    dicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiamic
    gnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnlls
    ftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrct
    tarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakke
    ggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnnev
    kqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgsd
    awkqymrrstctinyskdlplaqgikf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4zvwG (G:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvwG (G:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4zvwH (H:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvwH (H:)
    llinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyeet
    vkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqeyv
    dicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiamic
    gnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnlls
    ftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrct
    tarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakke
    ggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnnev
    kqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgsd
    awkqymrrstctinyskdlplaqgikf