PDB entry 4zvv

View 4zvv on RCSB PDB site
Description: Lactate dehydrogenase A in complex with a trisubstituted piperidine-2,4-dione inhibitor GNE-140
Class: Oxidoreductase/Oxidoreductase Inhibitor
Keywords: oxidoreductase inhibitor complex, LDHA-G02792140, Oxidoreductase-Oxidoreductase Inhibitor complex
Deposited on 2015-05-18, released 2016-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-18, with a file datestamp of 2016-05-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zvva1, d4zvva2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zvvb1, d4zvvb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zvvc1, d4zvvc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zvvd1, d4zvvd2
  • Heterogens: NAD, SO4, GN0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zvvA (A:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvvA (A:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zvvB (B:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvvB (B:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zvvC (C:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvvC (C:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zvvD (D:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zvvD (D:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf