PDB entry 4zv9

View 4zv9 on RCSB PDB site
Description: 2.00 Angstrom resolution crystal structure of an uncharacterized protein from Escherichia coli O157:H7 str. Sakai
Class: Structural Genomics, Unknown Function
Keywords: MCSG, Human Microbiome, Structural Genomics, PSI-Biology, Protein Structure Initiative, Midwest Center for Structural Genomics, Unknown Function
Deposited on 2015-05-18, released 2015-06-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-17, with a file datestamp of 2015-06-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ECs3884
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7AAT4 (3-237)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d4zv9a_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ECs3884
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7AAT4 (3-237)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d4zv9b_
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ECs3884
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7AAT4 (3-237)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d4zv9c_
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ECs3884
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7AAT4 (3-237)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d4zv9d_
  • Chain 'E':
    Compound: Uncharacterized protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ECs3884
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7AAT4 (3-237)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d4zv9e_
  • Chain 'F':
    Compound: Uncharacterized protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ECs3884
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7AAT4 (3-237)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d4zv9f_
  • Heterogens: GOL, PO4, PGE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zv9A (A:)
    snaqveftdpeifaeyitypspnghgevrgylvkpakmsgktpavvvvhenrglnpyied
    varrvakagyialapdglnsvggypgnddkgrelqqqvdptklmndffaaiefmqrypqa
    tgkvgitgfcygggvsnaaavaypelacavpfygrqaptadvakieaplllhfaeldtri
    negwpayeaalkannkvyeayiypgvnhgfhndstprydksaadlawqrtlkwfdkyl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zv9B (B:)
    snaqveftdpeifaeyitypspnghgevrgylvkpakmsgktpavvvvhenrglnpyied
    varrvakagyialapdglnsvggypgnddkgrelqqqvdptklmndffaaiefmqrypqa
    tgkvgitgfcygggvsnaaavaypelacavpfygrqaptadvakieaplllhfaeldtri
    negwpayeaalkannkvyeayiypgvnhgfhndstprydksaadlawqrtlkwfdkyl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zv9C (C:)
    snaqveftdpeifaeyitypspnghgevrgylvkpakmsgktpavvvvhenrglnpyied
    varrvakagyialapdglnsvggypgnddkgrelqqqvdptklmndffaaiefmqrypqa
    tgkvgitgfcygggvsnaaavaypelacavpfygrqaptadvakieaplllhfaeldtri
    negwpayeaalkannkvyeayiypgvnhgfhndstprydksaadlawqrtlkwfdkyl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zv9D (D:)
    snaqveftdpeifaeyitypspnghgevrgylvkpakmsgktpavvvvhenrglnpyied
    varrvakagyialapdglnsvggypgnddkgrelqqqvdptklmndffaaiefmqrypqa
    tgkvgitgfcygggvsnaaavaypelacavpfygrqaptadvakieaplllhfaeldtri
    negwpayeaalkannkvyeayiypgvnhgfhndstprydksaadlawqrtlkwfdkyl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zv9E (E:)
    snaqveftdpeifaeyitypspnghgevrgylvkpakmsgktpavvvvhenrglnpyied
    varrvakagyialapdglnsvggypgnddkgrelqqqvdptklmndffaaiefmqrypqa
    tgkvgitgfcygggvsnaaavaypelacavpfygrqaptadvakieaplllhfaeldtri
    negwpayeaalkannkvyeayiypgvnhgfhndstprydksaadlawqrtlkwfdkyl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zv9F (F:)
    snaqveftdpeifaeyitypspnghgevrgylvkpakmsgktpavvvvhenrglnpyied
    varrvakagyialapdglnsvggypgnddkgrelqqqvdptklmndffaaiefmqrypqa
    tgkvgitgfcygggvsnaaavaypelacavpfygrqaptadvakieaplllhfaeldtri
    negwpayeaalkannkvyeayiypgvnhgfhndstprydksaadlawqrtlkwfdkyl