PDB entry 4zrj

View 4zrj on RCSB PDB site
Description: Structure of Merlin-FERM and CTD
Class: signaling protein
Keywords: Merlin, FERM, CTD, SIGNALING PROTEIN
Deposited on 2015-05-12, released 2015-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: merlin
    Species: Homo sapiens [TaxId:9606]
    Gene: NF2, SCH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zrja1, d4zrja2, d4zrja3
  • Chain 'B':
    Compound: merlin
    Species: Homo sapiens [TaxId:9606]
    Gene: NF2, SCH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35240 (Start-89)
      • engineered mutation (12)
      • engineered mutation (79)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zrjA (A:)
    magaiasrmsfsslkrkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretw
    ffglqytikdtvawlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlffl
    qvkkqildekiycppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmt
    pemweeritawyaehrgrardeaemeylkiaqdlemygvnyfairnkkgtelllgvdalg
    lhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlc
    ignhdlfmrrrkadslevqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zrjA (A:)
    pktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmd
    kkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiycppeas
    vllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgr
    ardeaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpw
    neirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrkadslev
    qq
    

  • Chain 'B':
    No sequence available.