PDB entry 4zqs

View 4zqs on RCSB PDB site
Description: New compact conformation of linear Ub2 structure
Class: protein binding
Keywords: New compact conformation; linear polyubiquitin, PROTEIN BINDING
Deposited on 2015-05-11, released 2016-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zqsa1, d4zqsa2
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zqsb1, d4zqsb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zqsA (A:)
    gamgsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
    lsdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippd
    qqrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zqsA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zqsB (B:)
    gamgsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
    lsdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippd
    qqrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zqsB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrl