PDB entry 4zpt

View 4zpt on RCSB PDB site
Description: Structure of MERS-Coronavirus Spike Receptor-binding Domain (England1 Strain) in Complex with Vaccine-Elicited Murine Neutralizing Antibody D12 (Crystal Form 1)
Class: Viral protein/Immune system
Keywords: Vaccine, Immunogen, Viral protein-Immune system complex
Deposited on 2015-05-08, released 2015-10-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D12 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZPT (0-215)
  • Chain 'B':
    Compound: D12 Fab Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZPT (0-End)
    Domains in SCOPe 2.05: d4zptb1, d4zptb2
  • Chain 'H':
    Compound: D12 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZPT (0-215)
  • Chain 'L':
    Compound: D12 Fab Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZPT (0-End)
    Domains in SCOPe 2.05: d4zptl1, d4zptl2
  • Chain 'R':
    Compound: Spike glycoprotein
    Species: Human coronavirus EMC (isolate United Kingdom/H123990006/2012) [TaxId:1263720]
    Gene: S, 3
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Spike glycoprotein
    Species: Human coronavirus EMC (isolate United Kingdom/H123990006/2012) [TaxId:1263720]
    Gene: S, 3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zptB (B:)
    diqmtqttsslsaslgdrvtiicrasqdinnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgsdysltisnleqediatyfcqqantlpptfgagtklelrradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zptB (B:)
    diqmtqttsslsaslgdrvtiicrasqdinnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgsdysltisnleqediatyfcqqantlpptfgagtklelrradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4zptL (L:)
    diqmtqttsslsaslgdrvtiicrasqdinnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgsdysltisnleqediatyfcqqantlpptfgagtklelrradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zptL (L:)
    diqmtqttsslsaslgdrvtiicrasqdinnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgsdysltisnleqediatyfcqqantlpptfgagtklelrradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.