PDB entry 4zp1

View 4zp1 on RCSB PDB site
Description: Crystal structure of Zymomonas mobilis pyruvate decarboxylase variant Glu473Ala
Class: lyase
Keywords: thiamin diphosphate (ThDP), pyruvate decarboxylase, lyase
Deposited on 2015-05-07, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: pdc, ZMO1360
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06672
      • engineered mutation (472)
    Domains in SCOPe 2.07: d4zp1a1, d4zp1a2, d4zp1a3
  • Chain 'B':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: pdc, ZMO1360
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06672
      • engineered mutation (472)
    Domains in SCOPe 2.07: d4zp1b1, d4zp1b2, d4zp1b3
  • Chain 'C':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: pdc, ZMO1360
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06672
      • engineered mutation (472)
    Domains in SCOPe 2.07: d4zp1c1, d4zp1c2, d4zp1c3
  • Chain 'D':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: pdc, ZMO1360
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06672
      • engineered mutation (472)
    Domains in SCOPe 2.07: d4zp1d1, d4zp1d2, d4zp1d3
  • Heterogens: MG, NI, TPP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zp1A (A:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytiavmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zp1A (A:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytiavmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zp1B (B:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytiavmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zp1B (B:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytiavmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zp1C (C:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytiavmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zp1C (C:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytiavmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zp1D (D:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytiavmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zp1D (D:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytiavmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk