PDB entry 4zom

View 4zom on RCSB PDB site
Description: RORgamma in complex with inverse agonist 4j.
Class: transcription
Keywords: RORgamma Inverse Agonist, TRANSCRIPTION
Deposited on 2015-05-06, released 2015-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zoma_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zomb_
  • Chain 'C':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zomc_
  • Chain 'D':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zomd_
  • Heterogens: 4Q3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zomA (A:)
    gsaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zomA (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zomB (B:)
    gsaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zomB (B:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zomC (C:)
    gsaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zomC (C:)
    teiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhltea
    iqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmel
    fralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynle
    lafhhhlckthrqsilaklppkgklrslcsqhverlqif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zomD (D:)
    gsaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zomD (D:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppkgklrslcsqhv