PDB entry 4zml

View 4zml on RCSB PDB site
Description: Crystal structure of human P-cadherin (ss-dimer)
Class: cell adhesion
Keywords: dimerization, conformational change, CELL ADHESION
Deposited on 2015-05-04, released 2016-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: Cdh3, Cdhp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zmla1, d4zmla2
  • Heterogens: CA, CL, P6G, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zmlA (A:)
dwvvapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwl
llnkpldreeiakyelfghavsengasvedpmnisiivtdqndhkpkftqdtfrgsvleg
vlpgtsvmqvtatdeddaiytyngvvaysihsqepkdphdlmftihrstgtisvissgld
rekvpeytltiqatdmdgdgstttavavveild