PDB entry 4zmc

View 4zmc on RCSB PDB site
Description: Crystal structure of the PmFTN variant E130A soaked in iron (5 min)
Class: oxidoreductase
Keywords: ferritin, di-iron ferroxidase centre, 4-helix bundle, OXIDOREDUCTASE
Deposited on 2015-05-02, released 2015-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.06: d4zmca_
  • Chain 'B':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.06: d4zmcb_
  • Chain 'C':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (130)
    Domains in SCOPe 2.06: d4zmcc_
  • Chain 'D':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.06: d4zmcd_
  • Chain 'E':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.06: d4zmce_
  • Chain 'F':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.06: d4zmcf_
  • Chain 'G':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (130)
    Domains in SCOPe 2.06: d4zmcg_
  • Chain 'H':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (130)
    Domains in SCOPe 2.06: d4zmch_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zmcA (A:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zmcA (A:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvnaedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zmcB (B:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zmcB (B:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvnaedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zmcC (C:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zmcC (C:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvnaedkigsilakvtdenrtpgllrsldvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zmcD (D:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zmcD (D:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvnaedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zmcE (E:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zmcE (E:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvnaedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zmcF (F:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zmcF (F:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvnaedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4zmcG (G:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zmcG (G:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvnaedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4zmcH (H:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zmcH (H:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvnaedkigsilakvtdenrtpgllrsld