PDB entry 4zl5

View 4zl5 on RCSB PDB site
Description: Crystal structure of the PmFTN variant E44H soaked in iron (45 min)
Class: Oxidoreductase
Keywords: ferritin, di-iron ferroxidase centre, 4-helix bundle, Oxidoreductase
Deposited on 2015-05-01, released 2015-09-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (44)
    Domains in SCOPe 2.05: d4zl5a_
  • Chain 'B':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (44)
    Domains in SCOPe 2.05: d4zl5b_
  • Chain 'C':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (44)
    Domains in SCOPe 2.05: d4zl5c_
  • Chain 'D':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (44)
    Domains in SCOPe 2.05: d4zl5d_
  • Chain 'E':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (44)
    Domains in SCOPe 2.05: d4zl5e_
  • Chain 'F':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (44)
    Domains in SCOPe 2.05: d4zl5f_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zl5A (A:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zl5A (A:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zl5B (B:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zl5B (B:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zl5C (C:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zl5C (C:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zl5D (D:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zl5D (D:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zl5E (E:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zl5E (E:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zl5F (F:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zl5F (F:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlahsaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf