PDB entry 4zkh

View 4zkh on RCSB PDB site
Description: Crystal structure of the PmFTN variant E44Q soaked in iron (overnight)
Class: Oxidoreductase
Keywords: ferritin, di-iron ferroxidase centre, 4-helix bundle, Oxidoreductase
Deposited on 2015-04-30, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4zkha_
  • Chain 'B':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4zkhb_
  • Chain 'C':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4zkhc_
  • Chain 'D':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4zkhd_
  • Chain 'E':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4zkhe_
  • Chain 'F':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4zkhf_
  • Chain 'G':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4zkhg_
  • Chain 'H':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4zkhh_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zkhA (A:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkhA (A:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zkhB (B:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkhB (B:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zkhC (C:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkhC (C:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zkhD (D:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkhD (D:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zkhE (E:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkhE (E:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zkhF (F:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkhF (F:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4zkhG (G:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkhG (G:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4zkhH (H:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkhH (H:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf