PDB entry 4zkb

View 4zkb on RCSB PDB site
Description: The chemokine binding protein of orf virus complexed with CCL3
Class: Viral Protein/cytokine
Keywords: Complex, Orf chemokine binding protein, CCL3, Viral Protein-cytokine complex
Deposited on 2015-04-30, released 2015-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemokine binding protein
  Species: Orf virus (strain NZ2) [TaxId:10259]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2F862
• Chain 'B':
  Compound: C-C motif chemokine 3
  Species: Homo sapiens [TaxId:9606]
  Gene: CCL3, G0S19-1, MIP1A, SCYA3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10147
  Domains in SCOPe 2.08: d4zkbb_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4zkbB (B:)
  slaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
  yvsdlelsahhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4zkbB (B:)
  taccfsytsrqipdyfetssqcskpgvifltrqvcadpseewvqkyvsd