PDB entry 4zka

View 4zka on RCSB PDB site
Description: High Resolution Crystal Structure of Fox1 RRM
Class: RNA binding protein
Keywords: RRM RNA Binding, RNA binding protein
Deposited on 2015-04-30, released 2016-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA binding protein fox-1 homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBFOX1, A2BP, A2BP1, FOX1, HRNBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zkaa_
  • Chain 'B':
    Compound: RNA binding protein fox-1 homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBFOX1, A2BP, A2BP1, FOX1, HRNBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zkab_
  • Chain 'C':
    Compound: RNA binding protein fox-1 homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBFOX1, A2BP, A2BP1, FOX1, HRNBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zkac_
  • Chain 'D':
    Compound: RNA binding protein fox-1 homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBFOX1, A2BP, A2BP1, FOX1, HRNBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zkad_
  • Chain 'E':
    Compound: RNA binding protein fox-1 homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBFOX1, A2BP, A2BP1, FOX1, HRNBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zkae_
  • Chain 'F':
    Compound: RNA binding protein fox-1 homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBFOX1, A2BP, A2BP1, FOX1, HRNBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zkaf_
  • Heterogens: SO4, MES, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zkaA (A:)
    ntenksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensad
    adrareklhgtvvegrkievnnatarvmtnkktvnpytng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkaA (A:)
    enksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensadad
    rareklhgtvvegrkievnnata
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zkaB (B:)
    ntenksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensad
    adrareklhgtvvegrkievnnatarvmtnkktvnpytng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkaB (B:)
    enksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensadad
    rareklhgtvvegrkievnnata
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zkaC (C:)
    ntenksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensad
    adrareklhgtvvegrkievnnatarvmtnkktvnpytng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkaC (C:)
    qpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensadadrare
    klhgtvvegrkievnna
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zkaD (D:)
    ntenksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensad
    adrareklhgtvvegrkievnnatarvmtnkktvnpytng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkaD (D:)
    nksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensadadr
    areklhgtvvegrkievnnata
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zkaE (E:)
    ntenksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensad
    adrareklhgtvvegrkievnnatarvmtnkktvnpytng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkaE (E:)
    ksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensadadra
    reklhgtvvegrkievnnat
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zkaF (F:)
    ntenksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensad
    adrareklhgtvvegrkievnnatarvmtnkktvnpytng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkaF (F:)
    sqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensadadrar
    eklhgtvvegrkievnnat