PDB entry 4zjr

View 4zjr on RCSB PDB site
Description: RORgamma in complex with inverse agonist 48
Class: transcription
Keywords: RORgamma ligand binding domain, Inverse agonist, TRANSCRIPTION
Deposited on 2015-04-29, released 2015-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zjra_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zjrb_
  • Chain 'C':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • expression tag (1)
    Domains in SCOPe 2.07: d4zjrc1, d4zjrc2
  • Chain 'D':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4zjrd1, d4zjrd2
  • Heterogens: 4P3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zjrA (A:)
    gsaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zjrA (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zjrB (B:)
    gsaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zjrB (B:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zjrC (C:)
    gsaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zjrC (C:)
    saslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlckthrqsilaklppkgklrslcsqhverl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zjrD (D:)
    gsaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zjrD (D:)
    gsaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhve