PDB entry 4zhx

View 4zhx on RCSB PDB site
Description: Novel binding site for allosteric activation of AMPK
Class: transferase
Keywords: Transferase, serine/threonine kinase, allosteric activation, nucleotide-binding
Deposited on 2015-04-27, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-AMP-activated protein kinase catalytic subunit alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAA2, AMPK, AMPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54646
      • variant (283)
  • Chain 'B':
    Compound: 5'-AMP-activated protein kinase subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAB1, AMPK
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 5'-AMP-activated protein kinase catalytic subunit alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAA2, AMPK, AMPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54646
      • variant (283)
  • Chain 'D':
    Compound: 5'-AMP-activated protein kinase subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAB1, AMPK
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Prkag1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zhxe1, d4zhxe2
  • Chain 'F':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Prkag1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zhxf1, d4zhxf2
  • Heterogens: 4O7, C1V, C2Z, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zhxE (E:)
    madlnwetvissdsspavenehpqetpesnnsvytsfmkshrcydliptssklvvfdtsl
    qvkkaffalvtngvraaplwdskkqsfvgmltitdfinilhryyksalvqiyeleehkie
    twrevylqdsfkplvcispnaslfdavsslirnkihrlpvidpesgntlyilthkrilkf
    lklfitefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekg
    rvvdiyskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlvea
    evhrlvvvdendvvkgivslsdilqalvltggekkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zhxE (E:)
    svytsfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvgml
    titdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavssli
    rnkihrlpvidpesgntlyilthkrilkflklfitefpkpefmsksleelqigtyaniam
    vrtttpvyvalgifvqhrvsalpvvdekgrvvdiyskfdvinlaaektynnldvsvtkal
    qhrshyfegvlkcylhetletiinrlveaevhrlvvvdendvvkgivslsdilqalvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zhxF (F:)
    madlnwetvissdsspavenehpqetpesnnsvytsfmkshrcydliptssklvvfdtsl
    qvkkaffalvtngvraaplwdskkqsfvgmltitdfinilhryyksalvqiyeleehkie
    twrevylqdsfkplvcispnaslfdavsslirnkihrlpvidpesgntlyilthkrilkf
    lklfitefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekg
    rvvdiyskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlvea
    evhrlvvvdendvvkgivslsdilqalvltggekkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zhxF (F:)
    nsvytsfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvgm
    ltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavssl
    irnkihrlpvidpesgntlyilthkrilkflklfitefpkpefmsksleelqigtyania
    mvrtttpvyvalgifvqhrvsalpvvdekgrvvdiyskfdvinlaaektynnldvsvtka
    lqhrshyfegvlkcylhetletiinrlveaevhrlvvvdendvvkgivslsdilqalvlt