PDB entry 4zg1

View 4zg1 on RCSB PDB site
Description: Crystal structure of a nanobody raised against KDM5B
Class: protein binding
Keywords: Nanobody, Single domain antibody, CDR3 loop, beta sandwich, protein binding
Deposited on 2015-04-22, released 2015-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nb17
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZG1 (0-116)
    Domains in SCOPe 2.07: d4zg1a1, d4zg1a2
  • Chain 'B':
    Compound: nb17
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZG1 (0-116)
    Domains in SCOPe 2.07: d4zg1b1, d4zg1b2
  • Chain 'C':
    Compound: nb17
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZG1 (0-116)
    Domains in SCOPe 2.07: d4zg1c1, d4zg1c2
  • Chain 'D':
    Compound: nb17
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZG1 (0-End)
    Domains in SCOPe 2.07: d4zg1d1, d4zg1d2
  • Chain 'E':
    Compound: nb17
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZG1 (0-116)
    Domains in SCOPe 2.07: d4zg1e1, d4zg1e2
  • Chain 'F':
    Compound: nb17
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZG1 (0-116)
    Domains in SCOPe 2.07: d4zg1f1, d4zg1f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zg1A (A:)
    qvqlqesggglvqaggslrlscaasgstfgirtmgwyrqapgkqrdlvaiissggstdya
    dsvkgrftisrdnakntvylqmdslkpedtaiyycnarvgitmlahwgqgtqvtvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zg1B (B:)
    qvqlqesggglvqaggslrlscaasgstfgirtmgwyrqapgkqrdlvaiissggstdya
    dsvkgrftisrdnakntvylqmdslkpedtaiyycnarvgitmlahwgqgtqvtvss
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zg1C (C:)
    qvqlqesggglvqaggslrlscaasgstfgirtmgwyrqapgkqrdlvaiissggstdya
    dsvkgrftisrdnakntvylqmdslkpedtaiyycnarvgitmlahwgqgtqvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zg1D (D:)
    qvqlqesggglvqaggslrlscaasgstfgirtmgwyrqapgkqrdlvaiissggstdya
    dsvkgrftisrdnakntvylqmdslkpedtaiyycnarvgitmlahwgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zg1D (D:)
    qvqlqesggglvqaggslrlscaasgstfgirtmgwyrqapgkqrdlvaiissggstdya
    dsvkgrftisrdnakntvylqmdslkpedtaiyycnarvgitmlahwgqgtqvtvs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zg1E (E:)
    qvqlqesggglvqaggslrlscaasgstfgirtmgwyrqapgkqrdlvaiissggstdya
    dsvkgrftisrdnakntvylqmdslkpedtaiyycnarvgitmlahwgqgtqvtvss
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zg1F (F:)
    qvqlqesggglvqaggslrlscaasgstfgirtmgwyrqapgkqrdlvaiissggstdya
    dsvkgrftisrdnakntvylqmdslkpedtaiyycnarvgitmlahwgqgtqvtvss