PDB entry 4zfo

View 4zfo on RCSB PDB site
Description: J22.9-xi: chimeric mouse/human antibody against human BCMA (CD269)
Class: immune system
Keywords: antibody Fab-ligand complex anti-BCMA anti-tumor, immune system
Deposited on 2015-04-21, released 2015-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: J22.9-xi Fab, Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZFO (0-End)
  • Chain 'B':
    Compound: J22.9-xi Fab, Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZFO (0-212)
    Domains in SCOPe 2.05: d4zfob1, d4zfob2
  • Chain 'F':
    Compound: Tumor necrosis factor receptor superfamily member 17
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF17, BCM, BCMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4zfof_
  • Chain 'H':
    Compound: J22.9-xi Fab, Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZFO (0-220)
  • Chain 'K':
    Compound: Tumor necrosis factor receptor superfamily member 17
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF17, BCM, BCMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4zfok_
  • Chain 'L':
    Compound: J22.9-xi Fab, Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZFO (0-213)
    Domains in SCOPe 2.05: d4zfol1, d4zfol2
  • Heterogens: CU, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zfoB (B:)
divmtqsqrfmttsvgdrvsvtckasqsvdsnvawyqqkprqspkalifsaslrfsgvpa
rftgsgsgtdftltisnlqsedlaeyfcqqynnypltfgagtklelkrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrge

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >4zfoF (F:)
mlqmagqcsqneyfdsllhacipcqlrcssntppltcqrycnasvtnsvkgtna

    Sequence, based on observed residues (ATOM records): (download) 
    >4zfoF (F:)
gqcsqneyfdsllhacipcqlrcssntppltcqryc

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download) 
    >4zfoK (K:)
mlqmagqcsqneyfdsllhacipcqlrcssntppltcqrycnasvtnsvkgtna

    Sequence, based on observed residues (ATOM records): (download) 
    >4zfoK (K:)
qcsqneyfdsllhacipcqlrcssntppltcqryc

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zfoL (L:)
divmtqsqrfmttsvgdrvsvtckasqsvdsnvawyqqkprqspkalifsaslrfsgvpa
rftgsgsgtdftltisnlqsedlaeyfcqqynnypltfgagtklelkrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgea