PDB entry 4zff

View 4zff on RCSB PDB site
Description: Dual-acting Fab 5A12 in complex with VEGF
Class: signaling protein/immune system
Keywords: Fab, DAF, angiogenesis, Tie receptor, SIGNALING PROTEIN-IMMUNE SYSTEM complex
Deposited on 2015-04-21, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fragment antigen binding (Fab) 5A12 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZFF (0-End)
  • Chain 'B':
    Compound: Fragment antigen binding (Fab) 5A12 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZFF (0-End)
    Domains in SCOPe 2.07: d4zffb1, d4zffb2
  • Chain 'C':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Gene: VEGFA, VEGF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zffc_
  • Chain 'D':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Gene: VEGFA, VEGF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zffd_
  • Chain 'H':
    Compound: Fragment antigen binding (Fab) 5A12 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZFF (0-End)
  • Chain 'L':
    Compound: Fragment antigen binding (Fab) 5A12 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZFF (0-End)
    Domains in SCOPe 2.07: d4zffl1, d4zffl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zffB (B:)
    diqmtqspsslsasvgdrvtitcrasqflssfgvawyqqkpgkapklliygasslysgvp
    srfsgsgsgtdftltisslqpedfatyycqqgllspltfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zffB (B:)
    diqmtqspsslsasvgdrvtitcrasqflssfgvawyqqkpgkapklliygasslysgvp
    srfsgsgsgtdftltisslqpedfatyycqqgllspltfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zffC (C:)
    hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
    teesnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zffC (C:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zffD (D:)
    hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
    teesnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4zffL (L:)
    diqmtqspsslsasvgdrvtitcrasqflssfgvawyqqkpgkapklliygasslysgvp
    srfsgsgsgtdftltisslqpedfatyycqqgllspltfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zffL (L:)
    diqmtqspsslsasvgdrvtitcrasqflssfgvawyqqkpgkapklliygasslysgvp
    srfsgsgsgtdftltisslqpedfatyycqqgllspltfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg