PDB entry 4zes

View 4zes on RCSB PDB site
Description: Blood dendritic cell antigen 2 (BDCA-2) complexed with methyl-mannoside
Class: Carbohydrate-binding protein
Keywords: C-type lectin, carbohydrate-binding protein
Deposited on 2015-04-20, released 2015-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC4C, BDCA2, CLECSF11, CLECSF7, DLEC, HECL, UNQ9361/PRO34150
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTT0 (0-146)
      • engineered mutation (0)
    Domains in SCOPe 2.06: d4zesa_
  • Chain 'B':
    Compound: C-type lectin domain family 4 member C
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC4C, BDCA2, CLECSF11, CLECSF7, DLEC, HECL, UNQ9361/PRO34150
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTT0 (0-146)
      • engineered mutation (0)
    Domains in SCOPe 2.06: d4zesb_
  • Heterogens: MMA, CA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zesA (A:)
altcvmegkdiedwsccptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintree
qdfiiqnlkrnssyflglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfr
sseewgwndihchvpqksickmkkiyi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zesB (B:)
altcvmegkdiedwsccptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintree
qdfiiqnlkrnssyflglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfr
sseewgwndihchvpqksickmkkiyi