PDB entry 4zeh

View 4zeh on RCSB PDB site
Description: High resolution structure of Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus
Class: hydrolase
Keywords: TIM-barrel, dimer, glycoside hydrolase, 6-phospho-beta-galactosidase, hydrolase
Deposited on 2015-04-20, released 2016-06-29
Made obsolete by 5okb on 2017-10-18

The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zeha_
  • Chain 'B':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zehb_
  • Chain 'C':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zehc_
  • Chain 'D':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zehd_
  • Heterogens: IMD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zehA (A:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zehA (A:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
    rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
    wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zehB (B:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zehB (B:)
    hrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyh
    ryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtl
    yhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlg
    lhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvla
    fenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyq
    tttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglrig
    lrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgy
    cawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zehC (C:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zehC (C:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
    rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
    wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zehD (D:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zehD (D:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnpssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpilitenglge
    fdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlngyqkrygf
    vyvnrddesekdlrrikkksfywyqrvietngael