PDB entry 4zdu

View 4zdu on RCSB PDB site
Description: Crystal structure of importin-alpha bound to a non-classical nuclear localization signal of the influenza A virus nucleoprotein
Class: protein transport/signaling protein
Keywords: importin, NLS, PROTEIN TRANSPORT-SIGNALING PROTEIN complex
Deposited on 2015-04-19, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-1
    Species: Mus musculus [TaxId:10090]
    Gene: Kpna2, Rch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zdua_
  • Chain 'B':
    Compound: Peptide from Nucleoprotein
    Species: Influenza A virus (A/Puerto Rico/8/1934(H1N1)) [TaxId:211044]
    Gene: NP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zduA (A:)
    mgtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgk
    tdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgnia
    gdgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldave
    qilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpiv
    tpalraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqi
    qqvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnlls
    akdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykasln
    liekyfsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zduA (A:)
    wsvedivkginsnnlesqlqatqaarkllspidniiraglipkfvsflgktdcspiqfes
    awaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgsafrdlv
    ikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilptlvrll
    hhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpalraigni
    vtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvvnhglvp
    flvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdtkiiqvi
    ldaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliekyf
    

  • Chain 'B':
    No sequence available.