PDB entry 4zcp

View 4zcp on RCSB PDB site
Description: Crystal structure of the C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase in complex with CMP
Class: transferase
Keywords: enzyme, malaria, cytidylyltransferase, phosphatidylcholine, TRANSFERASE
Deposited on 2015-04-16, released 2016-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholinephosphate cytidylyltransferase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: ctP, MAL13P1.86
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zcpa_
  • Heterogens: C5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4zcpA (A:)
ghmavpdddddddnsndeseyessqmdseknkgsiknsknvviyadgvydmlhlghmkql
eqakklfenttlivgvtsdnetklfkgqvvqtleertetlkhirwvdeiispcpwvvtpe
flekykidyvahddipyannqkediyawlkragkfkatqrtegvsttdlivrilknyedy

    Sequence, based on observed residues (ATOM records): (download) 
    >4zcpA (A:)
knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
tlkhirwvdeiispcpwvvtpeflekykidyvahddidiyawlkragkfkatqrtegvst
tdlivrilk