PDB entry 4z93

View 4z93 on RCSB PDB site
Description: BRD4 bromodomain 2 in complex with gamma-carboline-containing compound, number 18.
Class: transcription
Keywords: Bromodomain,TRANSCRIPTION
Deposited on 2015-04-09, released 2015-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4z93a_
  • Heterogens: 4LD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4z93A (A:)
kvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpde