PDB entry 4z8y

View 4z8y on RCSB PDB site
Description: Crystal structure of Rab GTPase Sec4p mutant - S29V
Class: GTP binding protein
Keywords: GTPase, GDP bound, Rab, GTP binding protein
Deposited on 2015-04-09, released 2015-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein SEC4
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SEC4, SRO6, YFL005W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07560 (1-End)
      • engineered mutation (11)
    Domains in SCOPe 2.06: d4z8ya_
  • Chain 'B':
    Compound: Ras-related protein SEC4
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SEC4, SRO6, YFL005W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07560 (1-End)
      • engineered mutation (11)
    Domains in SCOPe 2.06: d4z8yb_
  • Heterogens: GDP, MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z8yA (A:)
    ssimkilligdvgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdta
    gqerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdm
    etrvvtadqgealakelgipfiessaknddnvneifftlakliqekidsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z8yA (A:)
    simkilligdvgvgkscllvrfvedkfnpgidfkiktvdingkkvklqlwdtagqerfrt
    ittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdmetrvvta
    dqgealakelgipfiessaknddnvneifftlakliqeki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z8yB (B:)
    ssimkilligdvgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdta
    gqerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdm
    etrvvtadqgealakelgipfiessaknddnvneifftlakliqekidsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z8yB (B:)
    simkilligdvgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdtag
    qerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdme
    trvvtadqgealakelgipfiessaknddnvneifftlakliqekid