PDB entry 4z8g

View 4z8g on RCSB PDB site
Description: Chimera of Tropomodulin-1 and Leiomodin-1 Actin-Binding Site 2 (TL1 ABS2)
Class: protein binding
Keywords: Actin Nucleator, Leucine Rich Repeat Domain, PROTEIN BINDING
Deposited on 2015-04-08, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tropomodulin-1, Leiomodin-1 chimera (TP1 ABS2)
    Species: Homo sapiens [TaxId:9606]
    Gene: LMOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z8ga_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z8gA (A:)
    masvikptqykpvpdeepnstdveetleriknndpkleevnlnnirnipiptlkayaeal
    kensyvkkfalantraddhvafaiaimlkanktitslnldsnhitgkgilaifrallqnn
    tltelrfhnqrhicggktemeiakllkenttllklgyhfelagprmtvtnllsrnmdkqr
    qkrlqeqrqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z8gA (A:)
    epnstdveetleriknndpkleevnlnnirnipiptlkayaealkensyvkkfalantra
    ddhvafaiaimlkanktitslnldsnhitgkgilaifrallqnntltelrfhnqrhicgg
    ktemeiakllkenttllklgyhfelagprmtvtnllsrnmdkqrqkrlqeqrqaq